Peptides
VL-LR3
Recombinant human Long R3 Insulin-like Growth Factor-1 (IGF-1 LR3) lyophilized powder for research use.
$69.99 1 mg
In stock
Not for human or veterinary use. Supplied for laboratory research only.
Volume pricing
Each at $69.99
Volume pricing applies to vials of the same product and size.
Quantity
- HPLC + MS verified
- COA for this lot
- Tracked, insured shipping
- Secure checkout
Free shipping on orders over $200.
Analytical specifications
| Chemical name | VL-LR3 |
|---|---|
| Class | Synthetic IGF-1 Analogue |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular weight | 9,117.60 g/mol |
| Molecular formula | C400H625N111O115S9 |
| CAS number | 946870-92-4 |
| Purity | ≥ 99.328% (HPLC) |
| Identity | Confirmed by mass spectrometry |
| Form | Lyophilized powder |
| Amount | 1 mg per vial |
| Storage | Store lyophilized, protected from light |
| Current lot | IGF-1-2026-0701 |
